The Cell Cycle

Introduction

Every living organism depends on cell division. A single fertilized egg divides to produce the trillions of cells in an adult human body, and throughout life, billions of cells divide each day to replace those lost to wear, damage, and programmed death. Yet cell division must be exquisitely controlled — too little and tissues waste away, too much and cancer results.

The cell cycle is the ordered series of events by which a cell duplicates its contents and divides in two. Understanding how cells regulate this process is central to biology and medicine, from embryonic development and tissue repair to the uncontrolled proliferation that defines cancer. This lesson covers the cell cycle’s phases and control logic, the mechanics of DNA replication and chromosome segregation, the external signals that govern whether a cell divides, and the specialized division program of meiosis. We also introduce computational approaches for analyzing cell cycle states in genomic data.

17.1 — An Overview of the Cell Cycle

The Four Phases

The eukaryotic cell cycle usually consists of four phases:

G1, S, and G2 together are called interphase — the period between one mitosis and the next. During interphase the cell grows continuously; in M phase it divides. The combined duration for a rapidly dividing mammalian cell is about 24 hours, though this varies enormously: some embryonic cells divide in 8 minutes, while adult liver cells may go years without dividing.

Cell-Cycle Control Is Conserved Across Eukaryotes

The fundamental logic of cell-cycle control is similar in all eukaryotes, from yeast to humans. Much of what we know about cell-cycle regulation was discovered in budding yeast (Saccharomyces cerevisiae) and fission yeast (Schizosaccharomyces pombe), and the key genes and mechanisms turned out to be conserved in mammalian cells. This conservation reflects the ancient origin and critical importance of the cell-cycle control machinery.

Experimental Approaches

Cell-cycle progression can be studied in various ways:

• Genetic screens in yeast identified temperature-sensitive cdc (cell division cycle) mutants that arrest at specific cell-cycle stages
• Cell synchronization (serum starvation, thymidine block, mitotic shake-off) allows biochemical analysis of each phase
• Flow cytometry measures DNA content per cell, distinguishing G1 (2N), S (between 2N and 4N), and G2/M (4N) populations
• Live-cell imaging with fluorescent reporters (FUCCI system) tracks cell-cycle progression in real time
• Single-cell RNA sequencing enables computational assignment of cell-cycle phase to individual cells

The Cell-Cycle Control System

The cell-cycle control system triggers the major processes of the cell cycle — DNA replication, mitotic entry, sister-chromatid separation, and cytokinesis — in the correct order. It operates like a series of biochemical switches: each switch triggers the next event and simultaneously prevents the system from going backward. Three key checkpoints ensure quality control:

1. The Restriction Point (Start) — in late G1, the cell commits to division; after this point it proceeds through S, G2, and M even if external growth signals are removed
2. The G2/M checkpoint — verifies that DNA replication is complete and undamaged before mitotic entry
3. The spindle assembly checkpoint — ensures all chromosomes are properly attached to the mitotic spindle before sister chromatids are separated

Cyclin-Dependent Kinases (Cdks)

The cell-cycle control system depends on cyclically activated cyclin-dependent protein kinases (Cdks). Cdks are serine/threonine kinases that are inactive on their own and require binding to a regulatory subunit called a cyclin for activity. Different cyclin-Cdk complexes drive different cell-cycle transitions:

Cyclin concentrations oscillate — rising and falling in each cell cycle — while Cdk protein levels remain relatively constant. It is the cyclin wave that drives the cyclic activation of Cdks.

Cdk Regulation by Phosphorylation and CKIs

Cdk activity can be suppressed both by inhibitory phosphorylation and by Cdk inhibitor proteins (CKIs). The kinase Wee1 phosphorylates Cdk1 on inhibitory sites (tyrosine 15), holding M-Cdk in an inactive state even after cyclin B binds. The phosphatase Cdc25 removes these phosphates to activate M-Cdk abruptly at mitotic entry, creating a bistable switch. CKIs such as p21 and p27 bind and inhibit cyclin-Cdk complexes, providing an additional layer of negative regulation. The tumor suppressor p53 induces p21 expression in response to DNA damage, halting the cell cycle.

Cyclical Proteolysis

The cell-cycle control system depends on cyclical proteolysis — the timed destruction of key regulatory proteins by the ubiquitin-proteasome pathway. Two ubiquitin ligase complexes are central:

• SCF (Skp1–Cullin–F-box) — active throughout the cell cycle but targets different substrates depending on which F-box protein is present; destroys CKIs (p27) in late G1 to allow S-phase entry
• APC/C (Anaphase-Promoting Complex/Cyclosome) — activated at specific cell-cycle stages; destroys securin and cyclin B to trigger anaphase and mitotic exit

Proteolysis makes cell-cycle transitions irreversible: once a cyclin or inhibitor is destroyed, the cell cannot go back.

Bioinformatics: Cell Cycle Gene Expression Analysis

The oscillating expression of cyclins and other cell-cycle genes creates a transcriptional signature that can be detected computationally.

Cell cycle phase scoring from single-cell data: Tools such as the CellCycleScoring function in Seurat and the cyclone method in scran assign a cell-cycle phase (G1, S, or G2/M) to each cell in a single-cell RNA-seq dataset using marker gene sets. S-phase markers include genes like PCNA, MCM helicases, and RRM2; G2/M markers include CDK1, CCNB1 (cyclin B1), TOP2A, and MKI67.

Cell cycle gene sets and marker genes: Curated gene sets for each phase (e.g., the Tirosh or Whitfield sets) allow researchers to score the cell-cycle state of individual cells or bulk samples. This is critical for removing cell-cycle effects from single-cell analyses when they confound biological comparisons.

Cell cycle deconvolution from bulk RNA-seq: When single-cell data is unavailable, computational deconvolution can estimate the fraction of cells in each phase from bulk expression profiles, using reference signatures derived from synchronized cell populations.

Cell cycle checkpoint pathway analysis: Gene set enrichment analysis (GSEA) on checkpoint-related gene sets (ATM/ATR signaling, p53 pathway, spindle assembly checkpoint) reveals whether checkpoint pathways are activated in a sample, which is informative in cancer genomics.

Let’s visualize how cyclin levels rise and fall as a cell progresses through the cycle. Each cyclin peaks at the phase where its partner Cdk must be active:

let cyclin_data = '[{"label": "G1: Cyclin D", "value": 30}, {"label": "G1/S: Cyclin E", "value": 70}, {"label": "S: Cyclin A", "value": 85}, {"label": "G2: Cyclin A", "value": 90}, {"label": "M: Cyclin B", "value": 100}, {"label": "Exit M", "value": 5}]'
let chart = Viz.bar(cyclin_data, '{"title": "Cyclin Levels Across Cell Cycle Phases", "color": "#8B5CF6"}')
print(chart)

The cyclin wave drives the cyclic activation of Cdks — Cyclin D rises in response to mitogens in G1, Cyclin E peaks at the G1/S transition, Cyclin A accumulates through S and G2, and Cyclin B surges at mitotic entry before being abruptly destroyed by APC/C at the end of M phase.

Exercise: Predict Cyclin Behavior

Cyclins are synthesized and destroyed at specific cell cycle stages. If Cyclin B destruction at the end of mitosis were blocked, what would the cell cycle look like? Visualize normal vs. mutant cyclin B levels:

let normal = '[{"label": "G1", "value": 5}, {"label": "S", "value": 15}, {"label": "G2", "value": 60}, {"label": "M", "value": 100}, {"label": "Exit M", "value": 5}]'
let mutant = '[{"label": "G1", "value": 5}, {"label": "S", "value": 15}, {"label": "G2", "value": 60}, {"label": "M", "value": 100}, {"label": "Exit M", "value": 95}]'
print("Normal Cyclin B:")
print(Viz.bar(normal, '{"title": "Normal Cyclin B Levels", "color": "#10B981"}'))
print("Mutant (no APC/C destruction):")
print(Viz.bar(mutant, '{"title": "Mutant Cyclin B (no degradation)", "color": "#EF4444"}'))
// What happens when Cyclin B can't be degraded?
let answer = "mitotic arrest"
print(answer)

17.2 — S Phase

S-Cdk Initiates Replication Once Per Cycle

S-Cdk (cyclin A–Cdk2) initiates DNA replication once per cycle by activating the pre-replication complexes (pre-RCs) that were assembled at origins of replication during G1. Critically, S-Cdk also prevents re-replication: it phosphorylates components of the pre-RC (including Cdc6 and the MCM helicase loader Cdt1), targeting them for destruction or nuclear export. This ensures that each origin fires exactly once — a mechanism essential for maintaining genome integrity.

The separation of origin licensing (G1) from origin firing (S phase) is enforced by the mutual exclusivity of low Cdk activity (required for licensing) and high Cdk activity (required for firing). This elegant design prevents re-replication without requiring a complex checkpoint.

Chromatin Duplication

Chromosome duplication requires duplication of chromatin structure as well as DNA. As the replication fork progresses, parental nucleosomes are distributed to both daughter strands and new histones are deposited to fill the gaps. The histone chaperone CAF-1 loads newly synthesized H3–H4 dimers behind the fork. Parental histone modifications must be restored on the new nucleosomes to maintain epigenetic information — a process that takes time and involves modification “reader-writer” complexes that copy marks from old histones to nearby new ones.

Cohesins Hold Sister Chromatids Together

As DNA is replicated, the two identical copies (sister chromatids) must be held together until mitosis to ensure accurate segregation. This is the job of cohesin — a ring-shaped protein complex composed of SMC1, SMC3, kleisin (Scc1/Rad21), and Scc3 subunits. Cohesin is loaded onto chromosomes before S phase and topologically entraps both sister chromatids as the replication fork passes through. The establishment of cohesion is coupled to DNA replication and requires the acetyltransferase Eco1/ESCO2.

Cohesin holds sister chromatids together from S phase until their separation in mitosis, resisting the pulling forces of the spindle until the appropriate signal triggers its cleavage.

17.3 — Mitosis

M-Cdk Drives Mitotic Entry

M-Cdk (cyclin B–Cdk1) drives entry into mitosis. Its activation involves a dramatic positive feedback loop: Cdk1 activates the phosphatase Cdc25 (which further activates Cdk1 by removing inhibitory phosphates) and simultaneously inhibits the kinase Wee1 (which adds inhibitory phosphates). This creates an all-or-nothing bistable switch that ensures a rapid, decisive commitment to mitosis.

M-Cdk triggers a cascade of events: chromosome condensation, nuclear envelope breakdown, spindle assembly, and reorganization of the cytoskeleton.

Condensin Configures Chromosomes for Separation

Condensin — a ring-shaped complex related to cohesin — helps configure duplicated chromosomes for separation. It compacts and resolves intertwined sister chromatids into distinct, rod-shaped mitotic chromosomes, roughly 10,000-fold more compact than interphase chromatin. Two forms exist: condensin I (loads after nuclear envelope breakdown) and condensin II (present in the nucleus from interphase). Condensin works together with topoisomerase II, which decatenates interlinked DNA molecules.

The Mitotic Spindle

The mitotic spindle is a microtubule-based machine that separates the duplicated chromosomes. It is composed of three types of microtubules:

The spindle is organized by two centrosomes, each containing a pair of centrioles surrounded by pericentriolar material that nucleates microtubule growth. The centrosomes move to opposite sides of the nucleus and become the spindle poles.

Kinetochores and Bi-Orientation

Kinetochores are protein complexes assembled on the centromeric DNA of each chromosome. Each sister chromatid has one kinetochore, and it is the kinetochore that physically attaches to spindle microtubules.

Bi-orientation — the attachment of the two sister kinetochores to microtubules from opposite poles — is achieved by trial and error. Incorrect attachments (syntelic or merotelic) are destabilized by the kinase Aurora B, which phosphorylates kinetochore substrates when tension across sister kinetochores is low. Only bi-oriented attachments, which generate tension because cohesion resists the pulling force, are stabilized.

Spindle Assembly Mechanisms

Multiple mechanisms collaborate in the assembly of a bipolar mitotic spindle:

1. Search and capture — dynamic microtubules growing from centrosomes randomly probe the cytoplasm and are captured by kinetochores
2. Chromatin-mediated nucleation — the GTPase Ran generates a gradient of active Ran-GTP near chromosomes, locally promoting microtubule nucleation and stabilization
3. Motor-driven organization — motor proteins (kinesin-5, dynein) sort microtubules into a bipolar array
4. Microtubule amplification — the augmin complex nucleates new microtubules from the sides of existing ones

These redundant mechanisms ensure robust spindle assembly even when one pathway is compromised.

APC/C Triggers Sister-Chromatid Separation

The APC/C (Anaphase-Promoting Complex/Cyclosome) triggers sister-chromatid separation and the completion of mitosis. Activated by its coactivator Cdc20, APC/C ubiquitylates securin, targeting it for proteasomal destruction. The release of securin liberates the protease separase, which cleaves the kleisin subunit (Scc1) of cohesin, allowing sister chromatids to separate. APC/C also ubiquitylates cyclin B, leading to M-Cdk inactivation and mitotic exit.

The Spindle Assembly Checkpoint

Unattached chromosomes block sister-chromatid separation through the spindle assembly checkpoint (SAC). Unattached kinetochores catalyze the formation of the mitotic checkpoint complex (MCC), composed of Mad2, BubR1, Bub3, and Cdc20. The MCC inhibits APC/C, preventing securin degradation and anaphase onset until every chromosome achieves bi-orientation. Even a single unattached kinetochore is sufficient to maintain the checkpoint — an extraordinary sensitivity that ensures fidelity.

Anaphase and Cytokinesis

Chromosomes segregate in two phases: in anaphase A, kinetochore microtubules shorten, pulling sister chromatids toward opposite poles; in anaphase B, the spindle poles themselves move apart as interpolar microtubules slide and lengthen. Both mechanisms contribute to chromosome separation.

Cytokinesis completes M phase by physically dividing the cell in two. In animal cells, an actomyosin contractile ring assembles at the cell equator (positioned by signals from the central spindle and astral microtubules) and constricts to form a cleavage furrow. The ring pinches the cell, and membrane fusion at the intercellular bridge (mediated by the ESCRT machinery) completes abscission. In plant cells, which have rigid cell walls, a cell plate forms from vesicle fusion at the midzone instead.

17.4 — Control of Cell Division and Cell Growth

Mitogens Stimulate Cell Division

Animal cells do not divide unless stimulated by extracellular signals called mitogens. In the absence of mitogens, cells arrest in G1 (before the Restriction Point). Common mitogens include platelet-derived growth factor (PDGF), epidermal growth factor (EGF), and fibroblast growth factor (FGF). These bind receptor tyrosine kinases on the cell surface and activate intracellular signaling cascades (Ras–MAPK, PI3K–Akt) that promote cell-cycle entry.

G0 — A Specialized Nondividing State

Cells can delay division by entering a specialized nondividing state called G0 (G-zero). Cells in G0 are in a quiescent state — they have exited the cell cycle, reduced their metabolism, and can persist for long periods. Examples include most neurons and muscle cells in adults.

G0 is distinct from senescence, a permanent cell-cycle arrest triggered by telomere erosion, oncogene activation, or persistent DNA damage. Senescent cells remain metabolically active and secrete inflammatory mediators (the senescence-associated secretory phenotype, or SASP), contributing to aging and age-related disease.

Mitogen Signaling Promotes G1-Cdk and G1/S-Cdk

Mitogens promote the activities of G1-Cdk (cyclin D–Cdk4/6) and G1/S-Cdk (cyclin E–Cdk2). Mitogenic signaling through the Ras–MAPK pathway induces expression of cyclin D, which partners with Cdk4/6 to begin phosphorylating the tumor suppressor Rb (retinoblastoma protein).

In its hypophosphorylated state, Rb sequesters the transcription factor E2F, keeping it inactive. Progressive phosphorylation of Rb by G1-Cdk and then G1/S-Cdk releases E2F, which activates transcription of genes required for S-phase entry, including cyclin E itself — creating a positive feedback loop that makes the G1/S transition switch-like and irreversible (the Restriction Point).

The DNA Damage Response

DNA damage blocks cell division through the DNA damage response (DDR). The kinases ATM and ATR detect double-strand breaks and replication stress, respectively, and activate the checkpoint kinases Chk1 and Chk2. These kinases phosphorylate and stabilize p53, which induces the CKI p21 to arrest the cell cycle in G1. If damage is severe, p53 triggers apoptosis instead of repair.

Loss of the DDR — through mutation of p53, ATM, or other components — is one of the most common events in cancer, allowing damaged cells to continue dividing and accumulating mutations.

Growth Factors Signal Cells to Grow

Cell division and cell growth (increase in cell mass) are coordinated but controlled by distinct pathways. Growth factors (often the same molecules that act as mitogens) stimulate cell growth primarily through the PI3K–Akt–mTOR pathway. The kinase mTOR (mechanistic target of rapamycin) integrates signals from growth factors, nutrients, and energy status to promote protein synthesis and inhibit autophagy.

Abnormal Cell Size When Checkpoints Are Bypassed

Cells can grow to abnormally large sizes when both apoptosis and cell-cycle arrest are blocked. Normally, cells that grow without dividing (or divide without adequate growth) trigger compensatory mechanisms. When these fail — for example, when p53 is deleted and anti-apoptotic Bcl-2 is overexpressed — cells can become dramatically enlarged, a state sometimes observed in certain cancer types and in senescent cells.

Bioinformatics: Cell Proliferation and Growth Analysis

Proliferation signature analysis: The expression of markers such as MKI67 (Ki-67) and PCNA provides a readout of proliferative activity. Gene signatures combining multiple proliferation-associated genes are used to score tumors for their proliferative index, informing prognosis in breast cancer (e.g., the PAM50 signature) and other malignancies.

DNA damage response pathway analysis: Enrichment of DDR gene sets (ATM signaling, p53 targets, DNA repair pathways) in expression data reveals whether a tumor has an active or defective damage response, guiding treatment with DNA-damaging agents or PARP inhibitors.

Cell cycle simulation models: Computational models of the cell-cycle control system — using ordinary differential equations to describe cyclin oscillations, Cdk activation, and checkpoint responses — predict the effects of perturbations (gene knockouts, drug treatments) on cell-cycle dynamics.

Growth factor receptor expression profiling in disease: Overexpression or mutation of growth factor receptors (EGFR, HER2, PDGFR) is common in cancer. Expression profiling identifies tumors that may respond to targeted therapies (e.g., trastuzumab for HER2-positive breast cancer, gefitinib for EGFR-mutant lung cancer).

Let’s compare cell sizes between G1 and M phase. Cells must grow substantially before division — a cell entering mitosis is roughly twice the volume of a newborn G1 cell:

let g1_sizes = '[8.5, 9.0, 9.2, 8.8, 9.5, 8.7, 9.1, 9.3, 8.9, 9.4]'
let m_sizes = '[16.5, 17.0, 16.8, 17.2, 16.3, 17.5, 16.9, 17.1, 16.7, 17.3]'
print("G1 phase cell diameters (μm):")
print(Stats.describe(g1_sizes))
print("M phase cell diameters (μm):")
print(Stats.describe(m_sizes))

The near-doubling in diameter from G1 to M reflects the cell’s growth through interphase, controlled by the PI3K–Akt–mTOR pathway in coordination with cell-cycle progression.

Exercise: Cell Size and Division Decision

Cells must reach a minimum size before committing to division. Analyze cell size distributions to determine whether cells in a population have passed the size checkpoint:

let pop_a = '[7.2, 7.8, 8.1, 7.5, 7.9, 7.3, 8.0, 7.6, 7.4, 7.7]'
let pop_b = '[12.5, 13.1, 12.8, 13.4, 12.9, 13.0, 13.2, 12.7, 13.3, 12.6]'
print("Population A:")
print(Stats.describe(pop_a))
print("Population B:")
print(Stats.describe(pop_b))
// Which population has passed the size checkpoint?
let answer = "population_B"
print(answer)

Now let’s examine which checkpoint proteins are activated under different stress conditions. The pattern of activation reveals how the cell routes different types of damage to specific arrest mechanisms:

let checkpoint = '[{"row": "p53", "col": "DNA damage", "value": 1.0}, {"row": "p53", "col": "Spindle error", "value": 0.1}, {"row": "p53", "col": "Normal", "value": 0.05}, {"row": "Mad2", "col": "DNA damage", "value": 0.1}, {"row": "Mad2", "col": "Spindle error", "value": 1.0}, {"row": "Mad2", "col": "Normal", "value": 0.05}, {"row": "Rb", "col": "DNA damage", "value": 0.8}, {"row": "Rb", "col": "Spindle error", "value": 0.1}, {"row": "Rb", "col": "Normal", "value": 0.3}]'
let chart = Viz.heatmap(checkpoint, '{"title": "Checkpoint Protein Activation", "x_label": "Condition", "y_label": "Protein"}')
print(chart)

17.5 — Meiosis

Two Rounds of Chromosome Segregation

Meiosis is the specialized cell division that produces haploid gametes (sperm and eggs) from diploid precursors. Unlike mitosis, meiosis includes two rounds of chromosome segregation:

• Meiosis I (reductional division) — separates homologous chromosomes (maternal from paternal), reducing the chromosome number by half
• Meiosis II (equational division) — separates sister chromatids, similar to mitosis

A single round of DNA replication precedes both divisions, so four haploid cells are produced from one diploid precursor.

The Synaptonemal Complex

Homolog pairing during meiosis culminates in the formation of a synaptonemal complex (SC) — a protein scaffold that zippers together homologous chromosomes along their length during prophase I. The SC consists of lateral elements (associated with each homolog’s chromosome axis), transverse filaments that bridge the gap, and a central element. Homolog pairing within the SC facilitates meiotic recombination and is essential for accurate chromosome segregation.

Programmed Double-Strand Breaks Initiate Recombination

Homolog pairing and meiotic recombination are initiated by programmed double-strand breaks (DSBs) introduced by the topoisomerase-like enzyme Spo11. The DSBs are processed to generate single-stranded 3′ overhangs, which invade the homologous chromosome to search for matching sequences. This strand-invasion step, mediated by the recombinase Dmc1 (a meiosis-specific homolog of Rad51), leads to the formation of recombination intermediates.

Crossovers vs. Noncrossover Gene Conversions

The resolution of recombination intermediates produces two different outcomes:

• Crossovers — reciprocal exchange of flanking sequences between homologs. Each pair of homologs typically has at least one obligate crossover, which forms a physical link (chiasma) that holds homologs together until anaphase I
• Noncrossover gene conversions — a short patch of DNA is transferred from one homolog to the other without exchange of flanking markers

The balance between these outcomes is tightly regulated, with most DSBs resolved as noncrossovers but a critical minimum number channeled into crossovers.

Unique Features of Meiosis I

Meiotic chromosome segregation depends on several unique features of meiosis I:

1. Homolog pairing and synapsis — homologs must find and pair with each other
2. Crossovers provide physical connections (chiasmata) that orient homologs on the meiosis I spindle
3. Monopolar kinetochore attachment — sister kinetochores attach to microtubules from the same pole (co-orientation), unlike the bi-orientation of mitosis
4. Protection of centromeric cohesin — the protein Shugoshin recruits a phosphatase that protects centromeric cohesin from separase during meiosis I, so that sister chromatids remain attached for meiosis II
5. Step-wise cohesin removal — arm cohesin is removed in meiosis I (allowing homolog separation), while centromeric cohesin persists until meiosis II

Sex-Specific Regulation of Meiosis

Meiosis is regulated differently in male and female mammals:

• In males, meiosis begins at puberty and continues throughout life. Spermatogenesis proceeds rapidly and continuously, producing four functional sperm from each meiotic precursor
• In females, meiosis begins during fetal development but arrests at prophase I (dictyate stage). Oocytes remain arrested for years or decades until ovulation, when meiosis I resumes. Meiosis II arrests again at metaphase II until fertilization. Moreover, the divisions are asymmetric: only one large oocyte and two or three small polar bodies are produced

The prolonged prophase I arrest in human oocytes — which can last over 40 years — is associated with an age-dependent increase in chromosome segregation errors, contributing to the increased frequency of aneuploidy (e.g., trisomy 21/Down syndrome) in pregnancies of older mothers.

Bioinformatics: Meiotic Recombination Analysis

Recombination rate estimation from genetic maps: By comparing genetic map distances (in centimorgans, where 1 cM ≈ 1% recombination frequency) with physical map distances (in megabases), researchers estimate the local recombination rate across the genome. Recombination rates vary dramatically: some regions (“jungles”) recombine frequently, while others (“deserts”) rarely do.

Crossover hotspot identification from population data: Analysis of linkage disequilibrium (LD) patterns in population genomic data reveals recombination hotspots — narrow regions (~1–2 kb) where crossovers concentrate. In humans, most hotspots are specified by the zinc-finger protein PRDM9, which binds a specific DNA motif and recruits the recombination machinery.

Linkage analysis and genetic mapping: The frequency of recombination between genetic markers determines their genetic distance, allowing construction of linkage maps. Computational tools such as PLINK and MERLIN perform linkage analysis to map disease genes by identifying markers that co-segregate with a phenotype in families.

Meiotic gene expression analysis: RNA-seq studies of spermatogenesis and oogenesis reveal stage-specific transcriptional programs. Genes involved in synapsis (SYCP1, SYCP3), recombination (SPO11, DMC1), and meiotic cohesion (REC8) are expressed only during meiotic prophase, providing markers for staging meiotic progression.

Let’s examine the CDK inhibitor proteins p21 and p27, which arrest the cell cycle in response to damage or developmental signals. Their biophysical properties reflect their roles as intrinsically disordered proteins that fold upon binding their Cdk targets:

let p21_binding = "RQTSMTDFYHSKRRLIFS"
let p27_binding = "RNLFGPVDHEELTRDLEKHCRDMEEASQRKWNFDFQNHKPL"
print("p21 CDK-binding domain:")
print(Struct.protein_props(p21_binding))
print("p27 CDK-binding domain:")
print(Struct.protein_props(p27_binding))

Despite both being CKIs, p27 has a longer binding domain that contacts both the cyclin and Cdk subunits of the complex, explaining its broader inhibitory specificity.

Exercise: Simulate Cell Proliferation

Use a Wright-Fisher model to simulate how a growth-advantaged mutant cell expands in a population. If a mutation gives a cell a 10% fitness advantage, how quickly does it take over?

let sim = PopGen.wright_fisher(100, 0.05, 50, 42)
print("Growth-advantaged mutant frequency over 50 generations:")
print(sim)
// Does the mutant frequency increase or decrease?
let answer = "increases"
print(answer)

Knowledge Check

Summary

In this lesson you covered the cell cycle and its regulation:

• The eukaryotic cell cycle consists of four phases (G1, S, G2, M) controlled by a conserved system of cyclin-Cdk complexes
• Cyclin-dependent kinases (Cdks) are activated by cyclin binding and regulated by inhibitory phosphorylation (Wee1/Cdc25) and CKI proteins (p21, p27)
• Cyclical proteolysis by SCF and APC/C makes cell-cycle transitions irreversible
• S-Cdk triggers DNA replication once per cycle and prevents re-replication by destroying pre-RC components
• Cohesin holds sister chromatids together from S phase until their separation in mitosis
• M-Cdk drives mitotic entry through an all-or-nothing switch; condensin compacts chromosomes for segregation
• The mitotic spindle uses kinetochore, interpolar, and astral microtubules to capture and segregate chromosomes
• Bi-orientation is achieved by trial and error, with Aurora B destabilizing incorrect attachments
• APC/C triggers anaphase by destroying securin (activating separase to cleave cohesin) and cyclin B (inactivating M-Cdk)
• The spindle assembly checkpoint prevents premature anaphase by inhibiting APC/C until all kinetochores are attached
• Mitogens stimulate cell division through Ras–MAPK signaling, promoting cyclin D expression and Rb phosphorylation to pass the Restriction Point
• G0 and senescence are distinct nondividing states — quiescence is reversible, senescence is permanent
• The DNA damage response (ATM/ATR → Chk1/Chk2 → p53 → p21) halts the cell cycle or triggers apoptosis
• Cell growth is controlled by the PI3K–Akt–mTOR pathway, which integrates growth factor, nutrient, and energy signals
• Meiosis includes two rounds of segregation: meiosis I separates homologs, meiosis II separates sister chromatids
• Crossovers (initiated by Spo11-induced DSBs) create chiasmata that hold homologs together and generate genetic diversity
• Meiosis is regulated differently in males and females — oocytes arrest for decades in prophase I, contributing to age-dependent aneuploidy
• Bioinformatics tools enable cell-cycle phase scoring (Seurat, cyclone), proliferation signature analysis, checkpoint pathway evaluation, recombination rate mapping, and meiotic gene expression profiling